PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopen02g027410.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family WOX
Protein Properties Length: 274aa    MW: 30745.4 Da    PI: 5.6102
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopen02g027410.1genomespennView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox68.39.4e-2294154257
                       T--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
          Homeobox   2 rkRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57 
                       r+R+t+t+ ql++Le+ Fe+ n +p++++++e++++l    +++e++V++WFqNrRa+ k+
  Sopen02g027410.1  94 RQRWTPTPMQLQILERIFEQgNGTPTKQKIKEITSELsqhgQISETNVYNWFQNRRARSKR 154
                       89*****************99**************************************97 PP

2Wus_type_Homeobox101.75.2e-3394156365
  Wus_type_Homeobox   3 rtRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65 
                        r+RWtPtp Q++iLe+++++G  tP+k++i++it+eL+++G+i+++NV++WFQNr+aR+++kq
   Sopen02g027410.1  94 RQRWTPTPMQLQILERIFEQGNGTPTKQKIKEITSELSQHGQISETNVYNWFQNRRARSKRKQ 156
                        89***********************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007115.32190155IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.603.2E-1890160IPR009057Homeodomain-like
SMARTSM003893.1E-1592159IPR001356Homeobox domain
SuperFamilySSF466892.4E-1992159IPR009057Homeodomain-like
CDDcd000861.20E-1594156No hitNo description
PfamPF000461.8E-1994154IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 274 aa     Download sequence    Send to blast
MDWEKQQQQP PVSAPQQTAE ELNGTVSGGM FVKVMTDEQM EVLRKQIAVY ATICEQLVDL  60
HKSMASQHDL AGARLGNLYC DPLVTSAGHK ITGRQRWTPT PMQLQILERI FEQGNGTPTK  120
QKIKEITSEL SQHGQISETN VYNWFQNRRA RSKRKQQVAA TNNTESEVET EVESPNEKKT  180
KPEDLQSSHM PTSMAEDLGY ENPDVSSGMH SLDPRTSKPE PMFPSDGSSK PAASYGQMSF  240
YGMSNPRMDQ LMGKMEVPGS YHPYIHADDY NMTG
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1147155RRARSKRKQ
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00669PBMTransfer from GRMZM2G038252Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754410.0HG975441.1 Solanum pennellii chromosome ch02, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004232569.10.0PREDICTED: WUSCHEL-related homeobox 8
RefseqXP_015064959.10.0PREDICTED: WUSCHEL-related homeobox 8
SwissprotQ5QMM38e-89WOX8_ORYSJ; WUSCHEL-related homeobox 8
TrEMBLK4BAD70.0K4BAD7_SOLLC; Uncharacterized protein
STRINGSolyc02g082670.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA56752437
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35550.16e-79WUSCHEL related homeobox 13